PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g13211.1.p
Common NameBRADI_4g13211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 658aa    MW: 74555.2 Da    PI: 6.4029
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g13211.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1682.4e-21127252290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk......................................tekerrtra 56 
                        Yn+YA+ +GFs++ ++s+ s  ++ + k++fvC++  k+++ +++                                       +k+rr+++
  Bradi4g13211.1.p 127 HYNAYARVMGFSIKSNTSRWSAYTNLVEKQQFVCNRFRKPKPVDDAagkssnptgnssrarrddsssdeehvdapnedpllvrkVVKKRRRES 219
                       6*****************************************99999************************************9999999*** PP

              FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        ++tgCkak++vk++ dg+wev+ ++ +HnHel 
  Bradi4g13211.1.p 220 IKQTGCKAKMTVKLT-DGRWEVIFFVADHNHELI 252
                       ***************.****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.5E-19127252IPR004330FAR1 DNA binding domain
PROSITE profilePS509669.137473509IPR007527Zinc finger, SWIM-type
PfamPF044341.1E-4480508IPR007527Zinc finger, SWIM-type
SMARTSM005750.0048484511IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MLDLNEIPCD LDDGFGGCVE PAYCTPAIPV AVHEEVGESP ATIRIADNEP LIRAPIAGDS  60
TAVADDTNVV ADDTNVVAED SVGVAEETTG VACDAPDNIE QEIECSSQPQ EPFLGMRFDT  120
LAGAKAHYNA YARVMGFSIK SNTSRWSAYT NLVEKQQFVC NRFRKPKPVD DAAGKSSNPT  180
GNSSRARRDD SSSDEEHVDA PNEDPLLVRK VVKKRRRESI KQTGCKAKMT VKLTDGRWEV  240
IFFVADHNHE LITKPSLTKY LLSHKNISPE EEAFLRILDD CNLETGQMMT LMSMFYANGF  300
IVPYTTKTIS NFRSNIRSER KGDDMAETVS YFMAKQKEDP SFYFNVKLDE DEREHADFTH  360
LYNIRRTWVP CYFQDCFFPF LQSTQRSEGF NAVLKRYVNP HNSILNFVKQ YEKIQVKILV  420
KEGGNDYRTD HLTQATWNEF MLTRRYNVRP QQNDLYRLEP NMTYCQFYGS RSYLVLARVV  480
DDEYSCECGK MKRDGLLCCH ILKVFTHLGI DEIPERYIMR RWTQNAVPRE VARLDETQPD  540
ALPLESLKQI RMANLSVKYG ELARISCCSD AANAIAEKYI RMTKTEITHL NLTRRKDAKR  600
RRETAAREAS AASASSAPAT THAATPPAPT TAPRLQQLQV VLQQLQPQPP QQQPPQQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3EJ070.0A0A0Q3EJ07_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-17FAR1-related sequence 5